Pay in 4 interest-free payments of $6.59 Learn more
Ships within 48 hours · Estimated delivery Sep 25 - Sep 30
Research Applications Cagrilintide is commonly utilized in laboratory settings for investigations involving: Amylin receptor (AMYR) and calcitonin receptor (CTR) binding and activation models Central nervous system satiety signaling and appetite-regulation pathways Gastric emptying deceleration and postprandial glucose entry kinetics Lipid metabolism, adipose tissue reduction, and body composition changes Glucagon secretion suppression models in pancreatic cells Dual-mechanism metabolic signaling when paired with GLP-1 receptor agonists (e -KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge: Cys3-Cys8) Molecular Classification: Long-Acting Acylated Amylin Analogue Research Category: Metabolic Regulation and Satiety Signaling Research Peptide Storage Store lyophilized Cagrilintide in a cool, dry environment away from direct light
These findings suggest that Epithalon might support mitochondrial integrity and functionality as oocytes age
10.4291/wjgp.v11.i1.1 23 GongG.WangP.DingW.ZhaoY.LiJ
Special bulk pricing and discounts for medical professionals
US$ 29.60
US$ 21.09
US$ 21.29
